Protein Info for SM_b20135 in Sinorhizobium meliloti 1021

Annotation: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02441: Flavoprotein
  • amino acids 9 to 179 (171 residues), 147 bits, E=1.9e-47
• TIGR00421: polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylases
  • amino acids 10 to 190 (181 residues), 237.4 bits, E=4.5e-75

Best Hits

Swiss-Prot: 62% identical to UBIX_THAAR: Flavin prenyltransferase UbiX (ubiX) from Thauera aromatica

KEGG orthology group: K03186, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiX [EC: 4.1.1.-] (inferred from 100% identity to sme:SM_b20135)

MetaCyc: 67% identical to flavin prenyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-16937 [EC: 2.5.1.129]

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase UbiX (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

• prenylated FMNH₂ biosynthesis (1/3 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (7/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (4/8 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Fluorene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Purine metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 2.5.1.129 or 4.1.1.-

Sequence Analysis Tools

See Q92X27 at UniProt or InterPro

Protein Sequence (210 amino acids)

>SM_b20135 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (Sinorhizobium meliloti 1021)
MKADREQRKRIIVGISGASGVIYGIRLLEILRDLDIETHLVMSRAAQITLAMETDFKVAD
VEALAACVHSNKDIGASCSSGSFRTLGMIVAPCSIKTLSEIATGVTSGLLSRAADVTLKE
RRRLVLMLRETPLHIGHIRSMAQATEAGAIICPPVPAFYARPQTLDEMVNHTVARVLDLF
DIDTGLAHRWSGLRAAVPDTRREDVEVKMR