Protein Info for SM_b20111 in Sinorhizobium meliloti 1021

Annotation: oligopeptide ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 PF00005: ABC_tran" amino acids 28 to 186 (159 residues), 99.4 bits, see alignment E=7.9e-32 amino acids 306 to 458 (153 residues), 118.9 bits, see alignment E=8.1e-38 PF08352: oligo_HPY" amino acids 237 to 273 (37 residues), 30.1 bits, see alignment 1.6e-10 amino acids 510 to 538 (29 residues), 27.6 bits, see alignment (E = 9.5e-10)

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to sme:SM_b20111)

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92X51 at UniProt or InterPro

Protein Sequence (546 amino acids)

>SM_b20111 oligopeptide ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MTGPHLLEVKDLTVDFLSLGGAFRATSGVSFHVDAGETLVILGESGSGKSVSASAIMGLI
DTPPGDICAGSVAYRGRDLSSLSEGERRDLNGRRIAMIFQDPLSHLNPVYTIGWQLEEVF
TVHGVASGAEARQRAIEILGRVGIPEPEKRIDQYPHQFSGGQRQRIMIGMAIALRPEILI
ADEPTTALDVSVQAQILELLKKLQAEDGLAIIMITHDLEVAANMADRVIVMKSGRIVEEG
EARAVFENPAHSYTRTLINALPHADDRAPPRPARPAGKPILEVKNIDKFYTLSSGFFAKP
ARLHAVKNLSFDVAAGETIGIVGESGSGKSTVARVLLGLNEASGGEALFHGRDVLKMDRK
QLLAFRRKVQMVFQDPYSSMNPRMTVFDIVSEPWRIHKDILEKTRWRDRVTELLGLVGLN
PEHAKRYPHQFSGGQRQRIAIARALACDPELVVCDEAVSALDVSVQVQVIDLLAELRDRL
GLAYIFITHDLPIVRHFADRIIVMKSGEIVEHATTEEIFRNPQHAYTRQLINATPKPKWQ
TAADAA