Protein Info for SM_b20109 in Sinorhizobium meliloti 1021

Annotation: peptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 226 to 252 (27 residues), see Phobius details amino acids 272 to 295 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 112 to 303 (192 residues), 126 bits, see alignment E=7.4e-41

Best Hits

Swiss-Prot: 35% identical to GSIC_SALPA: Glutathione transport system permease protein GsiC (gsiC) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to smk:Sinme_4058)

MetaCyc: 34% identical to glutathione ABC transporter membrane subunit GsiC (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92X53 at UniProt or InterPro

Protein Sequence (307 amino acids)

>SM_b20109 peptide ABC transporter permease (Sinorhizobium meliloti 1021)
MFAFILRRAGQSLIAVIGLLVLVFFLSRLTGDPAYLYLPLDSSEAQRQAFSETHGFNDPL
VVQFGRYLVDLARFDFGDALSRNRPAMEVALEAFPQTLKLAVIAIVLSLCFAVVVGSLAA
ARPNSLFDKIASTASLAGASAPDFWVAIVAILVFSVGLGLLPTSGTGTALHWIMPIFVLT
LRPFGLLVQVVRGTMMGALASPYVKTARAKGVNRSRIVFRHALRNSLLPVITVAGDLAAS
LVNGAVVVETIFGWPGIGKLMIDAIVRRDFALIQATVLVTAIAIFVLNIAIDLVYARLDP
RIRFETR