Protein Info for SM_b20104 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 62 (31 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details amino acids 183 to 208 (26 residues), see Phobius details amino acids 220 to 238 (19 residues), see Phobius details PF01925: TauE" amino acids 7 to 236 (230 residues), 99.9 bits, see alignment E=9.5e-33

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to sme:SM_b20104)

Predicted SEED Role

"Cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase (EC 1.8.1.8)" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange (EC 1.8.1.8)

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.8

Use Curated BLAST to search for 1.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92X58 at UniProt or InterPro

Protein Sequence (252 amino acids)

>SM_b20104 hypothetical protein (Sinorhizobium meliloti 1021)
MMDYLLLAASGFIAWIVSTIGGGGGAMLLVPLIGFIAGAQAVAPVVAVATLIAGGGRILI
FFGDIEWRVAAWGLPGAALGGVLGAAAFSNTSAEWLQIVVGLFLISTIFQYGFGRRERTF
AVATWWFFPAQFVVGFLSGLIGAIGPILNTLYLNAGITKEKMVGTKTAISLPMHLAKLRT
YTALGALTGKLLLFGIAAGLGALLSNWLAKRVLTNMSELNFRAIVVGFMALSGAVMIWEQ
RETLLRIFPGST