Protein Info for SM_b20069 in Sinorhizobium meliloti 1021

Annotation: amino acid carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 65 to 92 (28 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details amino acids 310 to 331 (22 residues), see Phobius details amino acids 351 to 374 (24 residues), see Phobius details amino acids 386 to 413 (28 residues), see Phobius details amino acids 419 to 438 (20 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 16 to 443 (428 residues), 487.4 bits, see alignment E=1.9e-150 PF01235: Na_Ala_symp" amino acids 59 to 450 (392 residues), 441.3 bits, see alignment E=2.1e-136

Best Hits

Swiss-Prot: 53% identical to AGCS_METMP: Sodium/alanine symporter AgcS (agcS) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 100% identity to sme:SM_b20069)

Predicted SEED Role

"Sodium/glycine symporter GlyP" in subsystem Glycine cleavage system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92X93 at UniProt or InterPro

Protein Sequence (467 amino acids)

>SM_b20069 amino acid carrier protein (Sinorhizobium meliloti 1021)
MEALNQFFNWLNGIVWGVPMIVLIIGTGLYLQLRLGFMPIRKVAYGFRMILKSRRPGRAA
EGEITPYAALMTALSATIGTGNIAGVATAIAVGGPGALFWMWVTAFVGMATKYAEVVVAV
KYREVDDKGEHAGGPMFAIKNGLGKHWQWLGTAFAIFGGLAGFGIGNMVQANGIASAVEN
AFGIETWISGIVMTVLTGAVILGGIKRIGAVAEKVVPFMAIFYLVCVAAVLVVFAGNIPQ
AIATIFTQAFSPTAATGGFLGSTVLMAIRMGVARGIFSNEAGLGTAGIAQAAGSTANPVF
SGVIGMMGTFIDTIIVCTLTGLAIMVSGVWASGETGAVLSSAAFEAALPGYGNYLVTISL
ALFAFTTILGWAYYAEKCWEYLIGTASAIPFRIVWTVAVFFGATLSLDFAWLVADTLNAL
MAIPNLISLLLLSPVIAQLTRDYFAEERAGAGVASHSQGQSASRKSV