Protein Info for SM_b20059 in Sinorhizobium meliloti 1021

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF01209: Ubie_methyltran" amino acids 45 to 152 (108 residues), 56.8 bits, see alignment E=6.8e-19 PF13489: Methyltransf_23" amino acids 48 to 151 (104 residues), 49.5 bits, see alignment E=1.2e-16 PF13847: Methyltransf_31" amino acids 53 to 160 (108 residues), 67.8 bits, see alignment E=2.9e-22 PF13649: Methyltransf_25" amino acids 55 to 146 (92 residues), 83.7 bits, see alignment E=3.7e-27 PF08241: Methyltransf_11" amino acids 56 to 150 (95 residues), 88.3 bits, see alignment E=1.3e-28 PF08242: Methyltransf_12" amino acids 56 to 148 (93 residues), 61.5 bits, see alignment E=3.1e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_4110)

Predicted SEED Role

"conserved hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XA3 at UniProt or InterPro

Protein Sequence (259 amino acids)

>SM_b20059 SAM-dependent methyltransferase (Sinorhizobium meliloti 1021)
MDMRNHDLKEDIREYWSKRSQTFDLAFGHRIPPGPELDAWAAAMRDALGARPLKVLELAC
GTGEVTNVLLSLGHEVTALDFSEAMLAVARRKHAGNDRVRFILADAERTMEPDETYDAVV
CRHLVWTLTEPEQAFAEWFRLLKPGGRLLVFDGDWSKPTPLGRLASIAVAALEQIIGHDP
HYDGAMSERHATIMERLPFGDGLTVERLLPLIEEAGFENIELPSRRPIAAAQRRNADLRN
RLRTFFYRRFFLVCSRPSG