Protein Info for SM_b20050 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20050)

Predicted SEED Role

"hypothetical transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XA9 at UniProt or InterPro

Protein Sequence (169 amino acids)

>SM_b20050 hypothetical protein (Sinorhizobium meliloti 1021)
MIPGSSIETLLALHVVVSLIGIASGLVALPTLGAGRWLGHWHAVFLVTTGATSITGFLFP
FSGITPALVVGAISVLTLAIALAALHVFGLRGRAGPAYAVSATFALYLNLFVLVVQSFLK
VPALQSIAPTQTEAPFVVAQALLLAASMALGAAAIIGSRQVALPLPVRG