Protein Info for SM_b20035 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 signal peptide" amino acids 7 to 8 (2 residues), see Phobius details transmembrane" amino acids 9 to 34 (26 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 78 to 101 (24 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 139 to 163 (25 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details amino acids 269 to 293 (25 residues), see Phobius details amino acids 313 to 339 (27 residues), see Phobius details amino acids 342 to 342 (1 residues), see Phobius details amino acids 355 to 376 (22 residues), see Phobius details amino acids 397 to 423 (27 residues), see Phobius details PF06808: DctM" amino acids 8 to 416 (409 residues), 411 bits, see alignment E=2.7e-127 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 419 (403 residues), 481 bits, see alignment E=1.3e-148

Best Hits

Swiss-Prot: 49% identical to Y050_HAEIN: Putative TRAP transporter large permease protein HI_0050 (HI_0050) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_4135)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XC4 at UniProt or InterPro

Protein Sequence (426 amino acids)

>SM_b20035 ABC transporter permease (Sinorhizobium meliloti 1021)
MTISIFLGALLGPMALGVPIAFALILSGVALMLYLGLFDAQIVAQNVLNGADSFPLMAVP
FFLLAGEVMNTGGLSRRIVALAMAMVGHIRGGLGFVAIFAACILSSLSGSAVADAAALGA
LLLPMMLKSGHDPARASGLIASASIIGPIIPPSIGFILFGVVGGVSITKLFLAGIFPGLM
IAAALSITWLIVARKEQFELPPRQSGRLRLRAFVDSLWALFLPVIIIAGLKFGVFTPTEA
GVIAAVYSLFVSMVVYRELAPAQLFHVFVSAAKISAVVMFLVACAAVSAWLITVADVPGA
LAALLEPLMGNQTALLIAIMVLIVIVGTAMDMTPTILIMTPVLMPVIKQAGIDPVYFGVL
FIINNSIGLITPPVGTVLNVICGVSKLSMEDLMKGVMPFLFAELIVLFLLVLFPELVTVP
VSWFGR