Protein Info for SM_b20015 in Sinorhizobium meliloti 1021

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 38 to 60 (23 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 246 to 263 (18 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 296 to 312 (17 residues), see Phobius details PF02653: BPD_transp_2" amino acids 39 to 306 (268 residues), 119.4 bits, see alignment E=8.2e-39

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to sme:SM_b20015)

Predicted SEED Role

"Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XE4 at UniProt or InterPro

Protein Sequence (318 amino acids)

>SM_b20015 sugar ABC transporter permease (Sinorhizobium meliloti 1021)
MSRVVSFVRQPIVVALVLIVLLLYLGEALSPGFATGGQILRLLIVASLLGIVAAGQNVVI
LGGREGIDLSVGGVVSLSAILAGNVMNGADGGILPAVAACLAAGAFFGLLNGLGVTLLRI
PPLVMTLGMLGVLQGLLVVIRMGIPSGQAAPALSRFVTQPLAYGIPGIIWLWIVIGILLA
LMLNRTVFGHRIYAIGSNEHAAYMAGVPVKLVRIALFMISGMFAATAGLCLLGYSGTSFA
NVGEQYMLPSIIAVVFGGTSLAGGKGGYTGTMAGAVLLVILQSILTTINIEESGRQMVFG
ATLLLLMMFYGRGRAMRA