Protein Info for SM_b20014 in Sinorhizobium meliloti 1021

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00356: LacI" amino acids 6 to 51 (46 residues), 60.3 bits, see alignment 2.6e-20 PF00532: Peripla_BP_1" amino acids 64 to 312 (249 residues), 102.1 bits, see alignment E=7.9e-33 PF13407: Peripla_BP_4" amino acids 67 to 308 (242 residues), 44.5 bits, see alignment E=3e-15 PF13377: Peripla_BP_3" amino acids 167 to 328 (162 residues), 123.8 bits, see alignment E=1.6e-39

Best Hits

Swiss-Prot: 41% identical to CYTR_ECO57: HTH-type transcriptional repressor CytR (cytR) from Escherichia coli O157:H7

KEGG orthology group: K05499, LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG (inferred from 100% identity to sme:SM_b20014)

Predicted SEED Role

"Transcriptional (co)regulator CytR" in subsystem CytR regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XE5 at UniProt or InterPro

Protein Sequence (333 amino acids)

>SM_b20014 transcriptional regulator (Sinorhizobium meliloti 1021)
MRDRPKIKDIAEKAGVSVATVSRALAASTLVTAETRQRVLDLARELDYRPNVSARNLRTR
RSMTVLMVVRDVGNPFYLDILKGVEATAREAGYAVLMGNTENDPARETEYFSMLRDGHAD
GMILMTGKLPSAGDWNHLPVVVALEMIEGSGLPHVQVDNVAAARGAVQHLISLGHRRIAH
ISGPVPEPMSVYRREGFRLAMRDAGLTIPAGYEVRGDFLIESGEECCRSLFSLSDPPTAL
FVANDEMAYGAVHELRRIGRDVPGDVSVVGFDDLYLSKAFYPPLTTVGQPRSEIGRTAMA
VLLGILAGGSEVAEPIVLPTVLKVRGSTAPPLI