Protein Info for SGL_RS18085 in Synechocystis sp000284455 PCC 6803

Annotation: molecular chaperone HtpG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 658 PF13589: HATPase_c_3" amino acids 30 to 148 (119 residues), 41.1 bits, see alignment E=2.7e-14 PF02518: HATPase_c" amino acids 31 to 175 (145 residues), 34.6 bits, see alignment E=3.5e-12 PF00183: HSP90" amino acids 206 to 389 (184 residues), 142.6 bits, see alignment E=3.2e-45 amino acids 421 to 653 (233 residues), 58.1 bits, see alignment E=1.3e-19

Best Hits

KEGG orthology group: K04079, molecular chaperone HtpG (inferred from 100% identity to syn:sll0430)

Predicted SEED Role

"Chaperone protein HtpG" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (658 amino acids)

>SGL_RS18085 molecular chaperone HtpG (Synechocystis sp000284455 PCC 6803)
MAVLEKGNITIHTENIFPIIKKSLYTDHEIFLRELISNAVDAISKRKMAAFASDGSGEVP
DPQITLVVDKVNKTLSITDNGIGMTADEVKKYINQVAFSSAEEFIEKFQKSANDLIGHFG
LGFYSAFMVSQKVEIDTLSYQEGAQAVHWSCDGSPEFELTDSDRQQVGTTVTLTLLDDEQ
EYLETGRIRQLVKTYSDFMAVPIRFEGETLNKQRAIWKESPQNLTKEDYLEFYRYLYPFQ
EDPLLWVHLNTDYPFLLNGILYFPKLRPDVDVSKGQIKLFCNQVFVSDHCEEVIPEFLMP
LRGVIDSPDIPLNVSRSALTNHRTVRRIADYIAKKVGDRLKSLYDENPAEYLKCWEDIGT
FVKFGSLREDKFKQQVEDLLLYRTTYKATAESTEPKVEVLTEDGDAWAETNQSDGVNPYE
KEGYTSLKRYLERNKERHENRVFYCTDQATQATYVELYKNQGIEVLFMDSFIDTNYFIPF
LEKEYSDVKFSRVDSELDQSLIEEDKASDIVDPATNKSRSEQIKEIFEKALNNPNINIKT
QSLKSDDPQSTPPAMVLLPEAMRRLQEMTAMMQQQAMAFPEQHVLAINTNHPLIKNILSL
SQGGIVTGSGESPSAELAKSLCQHVYDLALMAQKGFDAEGMKGFIERSNAVLTRLTKQ