Protein Info for SGL_RS17455 in Synechocystis sp000284455 PCC 6803

Annotation: WD40 repeat domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF00400: WD40" amino acids 57 to 89 (33 residues), 15.1 bits, see alignment 3e-05 amino acids 137 to 172 (36 residues), 39 bits, see alignment 7.7e-13 amino acids 178 to 217 (40 residues), 24.3 bits, see alignment 3.5e-08 amino acids 264 to 300 (37 residues), 20.6 bits, see alignment 5.1e-07 amino acids 304 to 342 (39 residues), 51.1 bits, see alignment 1.1e-16 PF12894: ANAPC4_WD40" amino acids 62 to 98 (37 residues), 21.5 bits, see alignment 2.2e-07 PF23749: DUF7165" amino acids 67 to 161 (95 residues), 29.5 bits, see alignment E=3.4e-10

Best Hits

Swiss-Prot: 100% identical to Y1491_SYNY3: Uncharacterized WD repeat-containing protein sll1491 (sll1491) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 100% identity to syn:sll1491)

Predicted SEED Role

"beta transducin-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>SGL_RS17455 WD40 repeat domain-containing protein (Synechocystis sp000284455 PCC 6803)
MNNYFPRLKQFSAPATFFLTVACLVYPGENAHANASTPNPYTVAQTTASPSVAVENLSGF
QGIITALNITPDGKYLAVATADNQITLIDLANQEVVYSQRSPVNNFADLAISADGQWLAI
AADNNVDVRRVRDGMRVETLVGHTDKVSGVAFSPDGETIVSVSGGDRTIRIWERASGNLI
QTLADNLGPTTSVVFTPDGSQFITGAIGQDRTIKFWDANTFELLGTSPQQPGFINGLAVT
PDGRKLVGAVRNFVKAWNLADAKELFSVRGPSLEINTIAVSPNNRWVATANKEGTIMIFD
LANGKQVTTLRGHQGWVLSLAFSPDGNTLYSGAEDKTVKIWDLSALAR