Protein Info for SGL_RS09390 in Synechocystis sp000284455 PCC 6803

Annotation: pentapeptide repeat-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF00805: Pentapeptide" amino acids 43 to 76 (34 residues), 24.8 bits, see alignment 2e-09 amino acids 62 to 100 (39 residues), 37.1 bits, see alignment 2.8e-13 amino acids 72 to 110 (39 residues), 37.9 bits, see alignment 1.5e-13 amino acids 102 to 140 (39 residues), 32.5 bits, see alignment 7.8e-12 amino acids 142 to 181 (40 residues), 30.1 bits, see alignment 4.1e-11 amino acids 167 to 201 (35 residues), 45.8 bits, see alignment 5e-16 amino acids 192 to 226 (35 residues), 47.7 bits, see alignment 1.4e-16 PF13599: Pentapeptide_4" amino acids 62 to 128 (67 residues), 27.3 bits, see alignment E=5.6e-10 amino acids 189 to 229 (41 residues), 28.4 bits, see alignment 2.5e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to syn:slr1519)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>SGL_RS09390 pentapeptide repeat-containing protein (Synechocystis sp000284455 PCC 6803)
MNYIMSNGLSPTPINAPGWLNSGVASLLVNGHVPQGLELTNQNLAGLVFPHGDLSQVALI
GCDLRFANLEGADLTDANLIAASLHKSNLRRANLCRATLNRCNLSEADLTESDANEALFC
QAVFTEVEAHGLRLYRAKVSQAQLMGAHLHQAYAPEADFSAVAAIAVDLRWANLRKTNFR
GADLRYGNFRGANLTQADFTGANLKGANLRGANLVGTNLQRADLSDVTW