Protein Info for SGL_RS02480 in Synechocystis sp000284455 PCC 6803

Annotation: translation initiation factor IF-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1001 PF04760: IF2_N" amino acids 4 to 49 (46 residues), 40 bits, see alignment 8.5e-14 amino acids 418 to 465 (48 residues), 50.1 bits, see alignment 5.7e-17 TIGR00487: translation initiation factor IF-2" amino acids 408 to 999 (592 residues), 934.6 bits, see alignment E=2.7e-285 TIGR00231: small GTP-binding protein domain" amino acids 496 to 656 (161 residues), 121.2 bits, see alignment E=3.8e-39 PF00009: GTP_EFTU" amino acids 498 to 657 (160 residues), 128.7 bits, see alignment E=6.1e-41 PF01926: MMR_HSR1" amino acids 498 to 607 (110 residues), 40.7 bits, see alignment E=7.1e-14 PF22042: EF-G_D2" amino acids 673 to 751 (79 residues), 94.8 bits, see alignment E=8.4e-31 PF11987: IF-2" amino acids 776 to 890 (115 residues), 131.2 bits, see alignment E=5.6e-42

Best Hits

Swiss-Prot: 100% identical to IF2_SYNY3: Translation initiation factor IF-2 (infB) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02519, translation initiation factor IF-2 (inferred from 100% identity to syn:slr0744)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (1001 amino acids)

>SGL_RS02480 translation initiation factor IF-2 (Synechocystis sp000284455 PCC 6803)
MNNAKVRIYDLSKELNLENRDILDICERLNVAAKSHSSTISESDAERIKAAAEKFTPQQP
KKPRVASRPESKEDKSDPKQQKILAIHHKQEKSGGPSPARPTPPPRPKLQAPKAPTPPQP
PVAKASAPKIQKQEEPAQEAPKSVAPPTQPLAPPPVPSLQSPPSKPAPPTPPAKKAAPAP
RLAGPPGRTASPNKTAVPAPAKPKVNRPEIVSLKDNRGQARSPGDREEKVAIAAPEPPKP
KVELRRPKPPRPEEDENLPELLEFPPLSRGKGVDGDNDADDGDLLSTEKPKPKLKRPTPP
RLGKPDQWEDDEDEKANKAKAANKGKRRPKMDDDDDDLDIDGDNGPKPTLVSLSIARPPK
PKSLAAKPSTPTVAKVKKPTLKSEAGSSAGGSSRSRGDRRDRKEVVQKPEVIMLDRSLTV
RDLADLLKISETDIIKRLFLKGVAVQITQTLDEETARMVAESFEVAVETPERVAAAAKTT
EMLDEADLDNLVRRPPVVTIMGHVDHGKTTLLDSIRKTKVAQGEAGGITQHIGAYHVEVE
HNDKTEQIVFLDTPGHEAFTAMRARGAKVTDIAILVVAADDGVQPQTKEAISHAKAAGVP
LIVAINKVDKPEANPDRIKQELSELGLLAEEWGGDTIMVPVSALNGDNLDGLLEMILLVS
EVEELVANPNRQAKGTVIEANLDRTRGPVATLLIQNGTLRVGDAIVVGAVYGKIRAMIDD
RGDKVEEASPSFAVEILGLGDVPAAGDEFEVFTNEKDARLQAEARAMEDRQTRLQQAMSS
RKVTLSSISAQAQEGELKELNIILKADVQGSLGAILGSLEQLPQGEVQIRVLLASPGEVT
ETDVDLAAASGAIIIGFNTTLASGARQAADQEGVDIREYDIIYKLLDDIQGAMEGLLDPE
EIESSLGTAEVRAVFPVGRGNIAGCYVQSGKIIRNRNLRVRRGDQVLFEGNIDSLKRIKE
DVREVNAGYECGIGCSKFNDWKEGDIIEAYEMTMKRRTLAT