Protein Info for Rv3922c in Mycobacterium tuberculosis H37Rv

Annotation: Possible hemolysin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 PF01809: YidD" amino acids 22 to 86 (65 residues), 97.1 bits, see alignment E=2.1e-32 TIGR00278: putative membrane protein insertion efficiency factor" amino acids 23 to 90 (68 residues), 94.3 bits, see alignment E=1.5e-31

Best Hits

Swiss-Prot: 99% identical to YIDD_MYCTO: Putative membrane protein insertion efficiency factor (MT4040.1) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K08998, hypothetical protein (inferred from 99% identity to mtc:MT4040.1)

Predicted SEED Role

"Protein YidD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (120 amino acids)

>Rv3922c Possible hemolysin (Mycobacterium tuberculosis H37Rv)
VSLSRQSCGRVVRVTGRASARGLIFVIQVYRHMLSPLRPASCRFVPTCSQYAVDALTEYG
LLRGSWLTMIRLAKCGPWHRGGWDPIPEGLTTGRSCQTDVDGANDDWNPASKRGERESFV