Protein Info for Rv3918c in Mycobacterium tuberculosis H37Rv

Annotation: Probable chromosome partitioning protein ParA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF10609: ParA" amino acids 84 to 241 (158 residues), 37.3 bits, see alignment E=7.3e-13 PF13614: AAA_31" amino acids 85 to 263 (179 residues), 195.6 bits, see alignment E=2.6e-61 PF09140: MipZ" amino acids 86 to 126 (41 residues), 31 bits, see alignment 5.9e-11 PF01656: CbiA" amino acids 87 to 313 (227 residues), 103.5 bits, see alignment E=2.9e-33 PF02374: ArsA_ATPase" amino acids 92 to 221 (130 residues), 31.9 bits, see alignment E=2.9e-11

Best Hits

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 100% identity to mtf:TBFG_13953)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA / Sporulation initiation inhibitor protein Soj" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>Rv3918c Probable chromosome partitioning protein ParA (Mycobacterium tuberculosis H37Rv)
VSAPWGPVAAGPSALVRSGQASTIEPFQREMTPPTPTPEAAHNPTMNVSRETSTEFDTPI
GAAAERAMRVLHTTHEPLQRPGRRRVLTIANQKGGVGKTTTAVNIAAALAVQGLKTLVID
LDPQGNASTALGITDRQSGTPSSYEMLIGEVSLHTALRRSPHSERLFCIPATIDLAGAEI
ELVSMVARENRLRTALAALDNFDFDYVFVDCPPSLGLLTINALVAAPEVMIPIQCEYYAL
EGVSQLMRNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVADEVRQYFGSKVLRTVIPR
SVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDRPPSAKGRP