Protein Info for Rv3914 in Mycobacterium tuberculosis H37Rv

Annotation: Thioredoxin TrxC (TRX) (MPT46)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 PF00085: Thioredoxin" amino acids 9 to 108 (100 residues), 116.7 bits, see alignment E=1.1e-37 TIGR01068: thioredoxin" amino acids 13 to 110 (98 residues), 133 bits, see alignment E=1.9e-43 PF13098: Thioredoxin_2" amino acids 23 to 105 (83 residues), 37 bits, see alignment E=9e-13 PF07689: KaiB" amino acids 57 to 105 (49 residues), 27.7 bits, see alignment E=4.4e-10

Best Hits

Swiss-Prot: 100% identical to THIO_MYCBO: Thioredoxin (trxA) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K03671, thioredoxin 1 (inferred from 100% identity to mbo:Mb3945)

MetaCyc: 56% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9 or 1.8.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (116 amino acids)

>Rv3914 Thioredoxin TrxC (TRX) (MPT46) (Mycobacterium tuberculosis H37Rv)
MTDSEKSATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTV
AKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAKGKAALLRELSDVVPNLN