Protein Info for Rv3858c in Mycobacterium tuberculosis H37Rv

Annotation: Probable NADH-dependent glutamate synthase (small subunit) GltD (L-glutamate synthase) (L-glutamate synthetase) (NADH-glutamate synthase) (glutamate synthase (NADH)) (GLTS beta chain) (NADPH-GOGAT)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01317: glutamate synthase, NADH/NADPH, small subunit
  • amino acids 3 to 477 (475 residues), 806.9 bits, E=3.4e-247
• PF14691: Fer4_20
  • amino acids 25 to 132 (108 residues), 85.9 bits, E=1e-27
• PF01494: FAD_binding_3
  • amino acids 146 to 177 (32 residues), 23.8 bits, see alignment (E = 1.5e-08)
• PF03486: HI0933_like
  • amino acids 146 to 180 (35 residues), 23.7 bits, 1.2e-08
• PF07992: Pyr_redox_2
  • amino acids 146 to 459 (314 residues), 92.7 bits, E=1.8e-29
• PF00890: FAD_binding_2
  • amino acids 147 to 181 (35 residues), 25.4 bits, 5e-09
• PF00070: Pyr_redox
  • amino acids 147 to 180 (34 residues), 26.2 bits, see alignment (E = 5.6e-09)
• PF12831: FAD_oxidored
  • amino acids 147 to 184 (38 residues), 30.8 bits, 1.3e-10
• PF01266: DAO
  • amino acids 147 to 180 (34 residues), 28.9 bits, see alignment (E = 5.2e-10)
• PF13450: NAD_binding_8
  • amino acids 149 to 183 (35 residues), 41.3 bits, 9.1e-14
• PF01593: Amino_oxidase
  • amino acids 155 to 184 (30 residues), 37 bits, see alignment (E = 1.6e-12)

Best Hits

Swiss-Prot: 100% identical to GLTD_MYCTO: Glutamate synthase [NADPH] small chain (gltD) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00266, glutamate synthase (NADPH/NADH) small chain [EC: 1.4.1.13 1.4.1.14] (inferred from 100% identity to mbo:Mb3888c)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• ammonia assimilation cycle I (2/2 steps found)
• L-glutamate biosynthesis IV (1/1 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• superpathway of ammonia assimilation (plants) (2/3 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13 or 1.4.1.14

Protein Sequence (488 amino acids)

>Rv3858c Probable NADH-dependent glutamate synthase (small subunit) GltD (L-glutamate synthase) (L-glutamate synthetase) (NADH-glutamate synthase) (glutamate synthase (NADH)) (GLTS beta chain) (NADPH-GOGAT) (Mycobacterium tuberculosis H37Rv)
MADPGGFLKYTHRKLPKRRPVPLRLRDWREVYEEFDNESLRQQATRCMDCGIPFCHNGCP
LGNLIPEWNDLVRRGRWRDAIERLHATNNFPDFTGRLCPAPCEPACVLGINQDPVTIKQI
ELEIIDKAFDEGWVQPRPPRKLTGQTVAVVGSGPAGLAAAQQLTRAGHTVTVFEREDRIG
GLLRYGIPEFKMEKRHLDRRLDQMRSEGTEFRPGVNVGVDISAEKLRADFDAVVLAGGAT
AWRELPIPGRELEGVHQAMEFLPWANRVQEGDDVLDEDGQPPITAKGKKVVIIGGGDTGA
DCLGTVHRQGAIAVHQFEIMPRPPDARAESTPWPTYPLMYRVSAAHEEGGERVFSVNTEA
FVGTDGRVSALRAHEVTMLDGKFVKVEGSDFELEADLVLLAMGFVGPERAGLLTDLGVKF
TERGNVARGDDFDTSVPGVFVAGDMGRGQSLIVWAIAEGRAAAAAVDRYLMGSSALPAPV
KPTAAPLQ