Protein Info for Rv3846 in Mycobacterium tuberculosis H37Rv

Annotation: Superoxide dismutase [FE] SodA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00081: Sod_Fe_N
  • amino acids 3 to 84 (82 residues), 109.6 bits, E=8.4e-36
• PF02777: Sod_Fe_C
  • amino acids 91 to 193 (103 residues), 120.8 bits, E=2.5e-39

Best Hits

Swiss-Prot: 100% identical to SODF_MYCTU: Superoxide dismutase [Fe] (sodB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 99% identity to mbb:BCG_3909)

Predicted SEED Role

"Superoxide dismutase [Mn/Fe] (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

• superoxide radicals degradation (2/2 steps found)
• reactive oxygen species degradation (3/4 steps found)
• ethene biosynthesis III (microbes) (5/7 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Protein Sequence (207 amino acids)

>Rv3846 Superoxide dismutase [FE] SodA (Mycobacterium tuberculosis H37Rv)
VAEYTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHSAIL
LNEKNLAFNLAGHVNHTIWWKNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAATTV
QGSGWAALGWDTLGNKLLIFQVYDHQTNFPLGIVPLLLLDMWEHAFYLQYKNVKVDFAKA
FWNVVNWADVQSRYAAATSQTKGLIFG