Protein Info for Rv3843c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 126 to 148 (23 residues), see Phobius details amino acids 165 to 191 (27 residues), see Phobius details amino acids 212 to 235 (24 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details PF14219: DUF4328" amino acids 152 to 306 (155 residues), 129.4 bits, see alignment E=5.2e-42

Best Hits

KEGG orthology group: None (inferred from 99% identity to mbt:JTY_3908)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>Rv3843c Probable conserved transmembrane protein (Mycobacterium tuberculosis H37Rv)
VIQVCSQCGTGWNVRERQRVWCPRCRGMLLAPLADMPAEARWRTPARPQVPTASDTRRTP
PRLPPGFRWIAVRPGAAPPPRHGPRLRGPTPRYAGIPRWGLTDHVDQAPVPASAKAGPSP
AAVRTTLLVSLLVFSIAVVVFVVRYVLLVINRNTLLNSVVASASVWLGVLVSLAAIAAAG
TTIVLLVRWLVARRAAAFMHQGLPERRSARELWAGCLLPMVNLLWAPLYVIELALVEDRY
TRLRRPIVVWWIVWIVSNAISMFAFATSWVTDAQGIANNTTMMVLAYLCAAAAVAAAARV
FEGFEQKPVERPAHRWVVVNTDGRSAPASSVAVELDGQEPAA