Protein Info for Rv3834c in Mycobacterium tuberculosis H37Rv

Annotation: SERYL-tRNA synthetase SerS (serine--tRNA ligase) (SERRS) (serine translase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 PF02403: Seryl_tRNA_N" amino acids 1 to 105 (105 residues), 88.1 bits, see alignment E=4.6e-29 TIGR00414: serine--tRNA ligase" amino acids 2 to 409 (408 residues), 409.4 bits, see alignment E=9.4e-127 PF00587: tRNA-synt_2b" amino acids 217 to 393 (177 residues), 105.8 bits, see alignment E=2.8e-34

Best Hits

Swiss-Prot: 100% identical to SYS_MYCBT: Serine--tRNA ligase (serS) from Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)

KEGG orthology group: K01875, seryl-tRNA synthetase [EC: 6.1.1.11] (inferred from 100% identity to mbt:JTY_3899)

Predicted SEED Role

"Seryl-tRNA synthetase (EC 6.1.1.11)" in subsystem Glycine and Serine Utilization (EC 6.1.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>Rv3834c SERYL-tRNA synthetase SerS (serine--tRNA ligase) (SERRS) (serine translase) (Mycobacterium tuberculosis H37Rv)
VIDLKLLRENPDAVRRSQLSRGEDPALVDALLTADAARRAVISTADSLRAEQKAASKSVG
GASPEERPPLLRRAKELAEQVKAAEADEVEAEAAFTAAHLAISNVIVDGVPAGGEDDYAV
LDVVGEPSYLENPKDHLELGESLGLIDMQRGAKVSGSRFYFLTGRGALLQLGLLQLALKL
AVDNGFVPTIPPVLVRPEVMVGTGFLGAHAEEVYRVEGDGLYLVGTSEVPLAGYHSGEIL
DLSRGPLRYAGWSSCFRREAGSHGKDTRGIIRVHQFDKVEGFVYCTPADAEHEHERLLGW
QRQMLARIEVPYRVIDVAAGDLGSSAARKFDCEAWIPTQGAYRELTSTSNCTTFQARRLA
TRYRDASGKPQIAATLNGTLATTRWLVAILENHQRPDGSVRVPDALVPFVGVEVLEPVA