Protein Info for Rv3809c in Mycobacterium tuberculosis H37Rv

Annotation: UDP-galactopyranose mutase Glf (UDP-GALP mutase) (NAD+-flavin adenine dinucleotide-requiring enzyme)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR00031: UDP-galactopyranose mutase" amino acids 8 to 384 (377 residues), 337.5 bits, see alignment E=4.8e-105 PF13450: NAD_binding_8" amino acids 12 to 81 (70 residues), 72.7 bits, see alignment E=3.6e-24 PF01593: Amino_oxidase" amino acids 19 to 95 (77 residues), 27.1 bits, see alignment E=3.9e-10 PF03275: GLF" amino acids 156 to 366 (211 residues), 274.6 bits, see alignment E=7.9e-86

Best Hits

Swiss-Prot: 100% identical to GLF_MYCTO: UDP-galactopyranose mutase (glf) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K01854, UDP-galactopyranose mutase [EC: 5.4.99.9] (inferred from 100% identity to mra:MRA_3849)

MetaCyc: 100% identical to UDP-galactopyranose mutase (Mycobacterium tuberculosis H37Rv)
UDP-galactopyranose mutase. [EC: 5.4.99.9]

Predicted SEED Role

"UDP-galactopyranose mutase (EC 5.4.99.9)" in subsystem LOS core oligosaccharide biosynthesis or linker unit-arabinogalactan synthesis (EC 5.4.99.9)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.99.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>Rv3809c UDP-galactopyranose mutase Glf (UDP-GALP mutase) (NAD+-flavin adenine dinucleotide-requiring enzyme) (Mycobacterium tuberculosis H37Rv)
MQPMTARFDLFVVGSGFFGLTIAERVATQLDKRVLVLERRPHIGGNAYSEAEPQTGIEVH
KYGAHLFHTSNKRVWDYVRQFTDFTDYRHRVFAMHNGQAYQFPMGLGLVSQFFGKYFTPE
QARQLIAEQAAEIDTADAQNLEEKAISLIGRPLYEAFVKGYTAKQWQTDPKELPAANITR
LPVRYTFDNRYFSDTYEGLPTDGYTAWLQNMAADHRIEVRLNTDWFDVRGQLRPGSPAAP
VVYTGPLDRYFDYAEGRLGWRTLDFEVEVLPIGDFQGTAVMNYNDLDVPYTRIHEFRHFH
PERDYPTDKTVIMREYSRFAEDDDEPYYPINTEADRALLATYRARAKSETASSKVLFGGR
LGTYQYLDMHMAIASALNMYDNVLAPHLRDGVPLLQDGA