Protein Info for Rv3779 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved transmembrane protein alanine and leucine rich

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 666 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 54 (24 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 289 to 317 (29 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details amino acids 391 to 412 (22 residues), see Phobius details amino acids 418 to 448 (31 residues), see Phobius details amino acids 457 to 481 (25 residues), see Phobius details amino acids 493 to 516 (24 residues), see Phobius details PF20176: DUF6541" amino acids 12 to 656 (645 residues), 270.9 bits, see alignment E=1.1e-84

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbo:Mb3808)

Predicted SEED Role

"FIG00820726: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (666 amino acids)

>Rv3779 Probable conserved transmembrane protein alanine and leucine rich (Mycobacterium tuberculosis H37Rv)
VGLWFGTLIALILLIAPGAMVARIAQLRWPVAIAVGPALTYGVVALAIIPYGALGIPWNG
WTALAALAVTCAVATGLQLLLARFRDLDAEALAVSRWPAVTVAAGVLLGALLIGWAAYRG
IPHWQSIPSTWDAVWHANTVRFILDTGQASSTHMGELRNVETHAPLYYPSVFHGLVAVFC
QLTGAAPTTGYTLSSLAASVWLFPVSAAVLTWRAVRSHPGALWSASCASAEWRAAGAAGT
AAALSASFTAVPYVEFDTAAMPNLAAYGIAVPTMVLITSTLRHRDRIPVAVLALVGVFSL
HITGGIVVALLVSAWWLFEALRHPVRSRLADLLTLAGVAAMAGLVMLPQFLSVRQQEDII
AGHAFPTYLSKKRGLFDAVFQHSRHLNDFPVQYALIVLAAIGGLILLVKKIWWPLAVWLL
LIVMNVDAGTPLGGPIGGVAGALGEFFYHDPRRIAAATTLLLMLMAGVALFATVMLLVAA
AKRLTDRFRPQPVSVWASATATLLIGATLVSAWHYFPRHRFLFGDKYDSVMIDQKDLDAM
AYLASLPGARDTLIGNANTDGTAWMYAVAGLHPLWTHYDYPLQQGPGYHRFIFWAYGRNG
ESDPRVLEAIQVLRIRYILTSTPTVRGFAVPDGLVSLETSRSWAKIYDNGEARIYEWRGT
AAATHS