Protein Info for Rv3774 in Mycobacterium tuberculosis H37Rv

Annotation: Possible enoyl-CoA hydratase EchA21 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF00378: ECH_1" amino acids 11 to 273 (263 residues), 138.4 bits, see alignment E=2.8e-44 PF16113: ECH_2" amino acids 18 to 200 (183 residues), 59.7 bits, see alignment E=3.7e-20

Best Hits

Swiss-Prot: 40% identical to ECH1_DICDI: Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial (ech1) from Dictyostelium discoideum

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 100% identity to mbt:JTY_3838)

Predicted SEED Role

"Enoyl-CoA hydratase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>Rv3774 Possible enoyl-CoA hydratase EchA21 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase) (Mycobacterium tuberculosis H37Rv)
MGETYESVTVETKDQVAQVTLIGPGKGNAMGPAFWSEMPEVFHALDADREVRAIVITGSG
KNFSYGLDVPAMGGMFAPLIADGALARPRTDFHTEILRMQKAINAVADCRTPTIAAVQGW
CIGGAVDLISAVDIRYASADAKFSVREVKLAIVADMGSLARLPLILSDGHLRELALTGKN
IDAARAEKIGLVNDVYDDADQTLAAAHATAAEIAANPPLAVYGIKDVLDQQRTSAVSENL
RYVAAWNAAFLPSKDLTEGISATFAKRPPQFTGE