Protein Info for Rv3770c in Mycobacterium tuberculosis H37Rv

Annotation: Hypothetical leucine rich protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 transmembrane" amino acids 19 to 36 (18 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 119 to 146 (28 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbb:BCG_3829c)

Predicted SEED Role

"FIG00820132: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (191 amino acids)

>Rv3770c Hypothetical leucine rich protein (Mycobacterium tuberculosis H37Rv)
MLSGIQQNTLMDNDPLAHGYYVADLLVALAVVVLMLRARRTRPELARMLLLGTLIGLVWE
LPVFGLSAWTNTPIIEWATPLPLPTVVFLLAHSVWDGPLLTMGWLLARALTGEPAGALGL
TVQVLWGQLTALAVELSAILAGTWSYVDDLWFNPVMFWFRGHPVTAAMQLTWLLAPLCFA
ALVRRLALTAR