Protein Info for Rv3759c in Mycobacterium tuberculosis H37Rv

Annotation: Possible osmoprotectant (glycine betaine/carnitine/choline/L-proline) binding lipoprotein ProX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF04069: OpuAC" amino acids 41 to 305 (265 residues), 175.4 bits, see alignment E=8.4e-56

Best Hits

KEGG orthology group: K05845, osmoprotectant transport system substrate-binding protein (inferred from 99% identity to mbb:BCG_3818c)

Predicted SEED Role

"L-proline glycine betaine binding ABC transporter protein ProX (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>Rv3759c Possible osmoprotectant (glycine betaine/carnitine/choline/L-proline) binding lipoprotein ProX (Mycobacterium tuberculosis H37Rv)
MRMLRRLRRATVAAAVWLATVCLVASCANADPLGSATGSVKSIVVGSGDFPESQVIAEIY
AQVLQANGFDVGRRLGIGSRETYILALKDHSIDLVPEYIGNLLLYFQPDATVTMLDAVEL
ELYKRLPGDLSILTPSPASDTDTVTVTAATAARWNLKTIADLAPHSADVKFAAPSAFQTR
PSGLPGLRHKYSLDIAPGNFVTINDGGGAVTVRALVEGTATAANLFSTSAAIPQNHLVVL
EDPEHNFLAGNIVPLVNSRKKSDHLKDVLDAVSAKLTTAGLAELNAAVSGNSGVDPDQAA
RKWVRDNGFDHPVRQ