Protein Info for Rv3754 in Mycobacterium tuberculosis H37Rv

Annotation: Prephenate dehydrogenase TyrA (PDH) (hydroxyphenylpyruvate synthase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02153: PDH_N
  • amino acids 9 to 152 (144 residues), 67.6 bits, E=9.4e-23
• PF20463: PDH_C
  • amino acids 156 to 240 (85 residues), 54.6 bits, E=1.2e-18

Best Hits

Swiss-Prot: 100% identical to TYRA_MYCTU: Prephenate dehydrogenase (tyrA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K04517, prephenate dehydrogenase [EC: 1.3.1.12] (inferred from 100% identity to mbb:BCG_3813)

Predicted SEED Role

"Arogenate dehydrogenase (EC 1.3.1.43)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 1.3.1.43)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• L-tyrosine biosynthesis I (3/3 steps found)
• L-tyrosine biosynthesis II (3/4 steps found)
• L-tyrosine biosynthesis III (3/4 steps found)
• superpathway of L-phenylalanine and L-tyrosine biosynthesis (3/5 steps found)
• 4-hydroxy-3-prenylbenzoate biosynthesis (1/4 steps found)
• superpathway of chorismate metabolism (40/59 steps found)
• superpathway of novobiocin biosynthesis (5/19 steps found)

KEGG Metabolic Maps

• Novobiocin biosynthesis
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.12 or 1.3.1.43

Protein Sequence (301 amino acids)

>Rv3754 Prephenate dehydrogenase TyrA (PDH) (hydroxyphenylpyruvate synthase) (Mycobacterium tuberculosis H37Rv)
MRAAAAAGREVFGYNRSVEGAHGARSDGFDAITDLNQTLTRAAATEALIVLAVPMPALPG
MLAHIRKSAPGCPLTDVTSVKCAVLDEVTAAGLQARYVGGHPMTGTAHSGWTAGHGGLFN
RAPWVVSVDDHVDPTVWSMVMTLALDCGAMVVPAKSDEHDAAAAAVSHLPHLLAEALAVT
AAEVPLAFALAAGSFRDATRVAATAPDLVRAMCEANTGQLAPAADRIIDLLSRARDSLQS
HGSIADLADAGHAARTRYDSFPRSDIVTVVIGADKWREQLAAAGRAGGVITSALPSLDSP
Q