Protein Info for Rv3754 in Mycobacterium tuberculosis H37Rv

Annotation: Prephenate dehydrogenase TyrA (PDH) (hydroxyphenylpyruvate synthase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 PF02153: PDH_N" amino acids 9 to 152 (144 residues), 67.6 bits, see alignment E=9.4e-23 PF20463: PDH_C" amino acids 156 to 240 (85 residues), 54.6 bits, see alignment E=1.2e-18

Best Hits

Swiss-Prot: 100% identical to TYRA_MYCTU: Prephenate dehydrogenase (tyrA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K04517, prephenate dehydrogenase [EC: 1.3.1.12] (inferred from 100% identity to mbb:BCG_3813)

Predicted SEED Role

"Arogenate dehydrogenase (EC 1.3.1.43)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 1.3.1.43)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.12 or 1.3.1.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>Rv3754 Prephenate dehydrogenase TyrA (PDH) (hydroxyphenylpyruvate synthase) (Mycobacterium tuberculosis H37Rv)
MRAAAAAGREVFGYNRSVEGAHGARSDGFDAITDLNQTLTRAAATEALIVLAVPMPALPG
MLAHIRKSAPGCPLTDVTSVKCAVLDEVTAAGLQARYVGGHPMTGTAHSGWTAGHGGLFN
RAPWVVSVDDHVDPTVWSMVMTLALDCGAMVVPAKSDEHDAAAAAVSHLPHLLAEALAVT
AAEVPLAFALAAGSFRDATRVAATAPDLVRAMCEANTGQLAPAADRIIDLLSRARDSLQS
HGSIADLADAGHAARTRYDSFPRSDIVTVVIGADKWREQLAAAGRAGGVITSALPSLDSP
Q