Protein Info for Rv3738c in Mycobacterium tuberculosis H37Rv

Annotation: PPE family protein PPE66

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 94 to 99 (6 residues), see Phobius details amino acids 104 to 158 (55 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details PF00823: PPE" amino acids 2 to 73 (72 residues), 86.2 bits, see alignment E=2.7e-28 PF18878: PPE-PPW" amino acids 259 to 305 (47 residues), 72.1 bits, see alignment 3e-24

Best Hits

Swiss-Prot: 100% identical to PPE66_MYCTO: Uncharacterized PPE family protein PPE66 (PPE66) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_03783)

Predicted SEED Role

"PPE family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>Rv3738c PPE family protein PPE66 (Mycobacterium tuberculosis H37Rv)
MTTAYASALAAMPTLTELAANHTSHAVLLGTNFFGINTIPIALNEADYARMWIQAATTMS
IYEGTSDAALASAPQTTPAPVLFNGGAGVASALPAISAATLDPASIIGIIIEILIQLFLI
SLEILFAIVAYTIIIVLILPLVIFAYAIVFAVLAIIFGPPLLVIASPFVLTGSVIAVPTS
LSTSLSTAVPIGVGQYLADLASADAQAIEVGLKTADVAPVAVRPAAAPPLRESAAVRPEA
RLVSAVAPAPAGTSASVLASDRGAGVLGFAGTAGKESVGRPAGLTTLAGGEFGGSPSVPM
VPASWEQLVGAGEAG