Protein Info for Rv3721c in Mycobacterium tuberculosis H37Rv

Annotation: DNA polymerase III (subunit gamma/tau) DnaZ/X

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 TIGR02397: DNA polymerase III, subunit gamma and tau" amino acids 2 to 360 (359 residues), 375.7 bits, see alignment E=1.3e-116 PF13177: DNA_pol3_delta2" amino acids 18 to 175 (158 residues), 130.7 bits, see alignment E=1.6e-41 PF00004: AAA" amino acids 39 to 169 (131 residues), 39.3 bits, see alignment E=2.5e-13 PF13401: AAA_22" amino acids 39 to 154 (116 residues), 28.3 bits, see alignment E=5.9e-10 PF22608: DNAX_ATPase_lid" amino acids 185 to 225 (41 residues), 27.2 bits, see alignment 8.4e-10 PF12169: DNA_pol3_gamma3" amino acids 235 to 362 (128 residues), 51.1 bits, see alignment E=3.8e-17

Best Hits

Swiss-Prot: 100% identical to DPO3X_MYCBO: DNA polymerase III subunit gamma/tau (dnaX) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K02343, DNA polymerase III subunit gamma/tau [EC: 2.7.7.7] (inferred from 100% identity to mbb:BCG_3781c)

Predicted SEED Role

"DNA polymerase III subunits gamma and tau (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (578 amino acids)

>Rv3721c DNA polymerase III (subunit gamma/tau) DnaZ/X (Mycobacterium tuberculosis H37Rv)
VALYRKYRPASFAEVVGQEHVTAPLSVALDAGRINHAYLFSGPRGCGKTSSARILARSLN
CAQGPTANPCGVCESCVSLAPNAPGSIDVVELDAASHGGVDDTRELRDRAFYAPVQSRYR
VFIVDEAHMVTTAGFNALLKIVEEPPEHLIFIFATTEPEKVLPTIRSRTHHYPFRLLPPR
TMRALLARICEQEGVVVDDAVYPLVIRAGGGSPRDTLSVLDQLLAGAADTHVTYTRALGL
LGVTDVALIDDAVDALAACDAAALFGAIESVIDGGHDPRRFATDLLERFRDLIVLQSVPD
AASRGVVDAPEDALDRMREQAARIGRATLTRYAEVVQAGLGEMRGATAPRLLLEVVCARL
LLPSASDAESALLQRVERIETRLDMSIPAPQAVPRPSAAAAEPKHQPAREPRPVLAPTPA
SSEPTVAAVRSMWPTVRDKVRLRSRTTEVMLAGATVRALEDNTLVLTHESAPLARRLSEQ
RNADVLAEALKDALGVNWRVRCETGEPAAAASPVGGGANVATAKAVNPAPTANSTQRDEE
EHMLAEAGRGDPSPRRDPEEVALELLQNELGARRIDNA