Protein Info for Rv3680 in Mycobacterium tuberculosis H37Rv

Annotation: Probable anion transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 PF02374: ArsA_ATPase" amino acids 20 to 285 (266 residues), 91.1 bits, see alignment E=1.6e-29 PF01656: CbiA" amino acids 21 to 259 (239 residues), 33.7 bits, see alignment E=6.3e-12 PF13614: AAA_31" amino acids 26 to 162 (137 residues), 39 bits, see alignment E=1.6e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_13711)

Predicted SEED Role

"Arsenical pump-driving ATPase (EC 3.6.3.16)" in subsystem Arsenic resistance (EC 3.6.3.16)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.16

Use Curated BLAST to search for 3.6.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>Rv3680 Probable anion transporter ATPase (Mycobacterium tuberculosis H37Rv)
MSVTPKTLDMGAILADTSNRVVVCCGAGGVGKTTTAAALALRAAEYGRTVVVLTIDPAKR
LAQALGINDLGNTPQRVPLAPEVPGELHAMMLDMRRTFDEMVMQYSGPERAQSILDNQFY
QTVATSLAGTQEYMAMEKLGQLLSQDRWDLIVVDTPPSRNALDFLDAPKRLGSFMDSRLW
RLLLAPGRGIGRLITGVMGLAMKALSTVLGSQMLADAAAFVQSLDATFGGFREKADRTYA
LLKRRGTQFVVVSAAEPDALREASFFVDRLSQESMPLAGLVFNRTHPMLCALPIERAIDA
AETLDAETTDSDATSLAAAVLRIHAERGQTAKREIRLLSRFTGANPTVPVVGVPSLPFDV
SDLEALRALADQLTTVGNDAGRAAGR