Protein Info for Rv3665c in Mycobacterium tuberculosis H37Rv

Annotation: Probable dipeptide-transport integral membrane protein ABC transporter DppB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 131 to 155 (25 residues), see Phobius details amino acids 175 to 191 (17 residues), see Phobius details amino acids 230 to 255 (26 residues), see Phobius details amino acids 276 to 300 (25 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 4 to 77 (74 residues), 27 bits, see alignment E=4.4e-10 PF00528: BPD_transp_1" amino acids 113 to 306 (194 residues), 119.7 bits, see alignment E=1.2e-38

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to mtu:Rv3665c)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>Rv3665c Probable dipeptide-transport integral membrane protein ABC transporter DppB (Mycobacterium tuberculosis H37Rv)
MGWYVARRVAVMVPVFLGATLLIYGMVFLLPGDPVAALAGDRPLTPAVAAQLRSHYHLDD
PFLVQYLRYLGGILHGDLGRAYSGLPVSAVLAHAFPVTIRLALIALAVEAVLGIGFGVIA
GLRQGGIFDSAVLVTGLVIIAIPIFVLGFLAQFLFGVQLEIAPVTVGERASVGRLLLPGI
VLGAMSFAYVVRLTRSAVAANAHADYVRTATAKGLSRPRVVTVHILRNSLIPVVTFLGAD
LGALMGGAIVTEGIFNIHGVGGVLYQAVTRQETPTVVSIVTVLVLIYLITNLLVDLLYAA
LDPRIRYG