Protein Info for Rv3585 in Mycobacterium tuberculosis H37Rv

Annotation: DNA repair protein RadA (DNA repair protein SMS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 TIGR00416: DNA repair protein RadA" amino acids 1 to 445 (445 residues), 475.6 bits, see alignment E=7.5e-147 PF18073: Rubredoxin_2" amino acids 8 to 35 (28 residues), 41.6 bits, see alignment (E = 2.6e-14) PF06745: ATPase" amino acids 70 to 141 (72 residues), 46.8 bits, see alignment E=9e-16 PF13481: AAA_25" amino acids 75 to 221 (147 residues), 65.8 bits, see alignment E=1.5e-21 PF00004: AAA" amino acids 92 to 192 (101 residues), 26.9 bits, see alignment E=2.1e-09 PF13541: ChlI" amino acids 365 to 427 (63 residues), 32.4 bits, see alignment E=2.6e-11 PF05362: Lon_C" amino acids 366 to 428 (63 residues), 22.8 bits, see alignment E=2.2e-08

Best Hits

Swiss-Prot: 100% identical to RADA_MYCTU: DNA repair protein RadA (radA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K04485, DNA repair protein RadA/Sms (inferred from 100% identity to mtc:MT3691)

Predicted SEED Role

"DNA repair protein RadA" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (480 amino acids)

>Rv3585 DNA repair protein RadA (DNA repair protein SMS) (Mycobacterium tuberculosis H37Rv)
VANARSQYRCSECRHVSAKWVGRCLECGRWGTVDEVAVLSAVGGTRRRSVAPASGAVPIS
AVDAHRTRPCPTGIDELDRVLGGGIVPGSVTLLAGDPGVGKSTLLLEVAHRWAQSGRRAL
YVSGEESAGQIRLRADRIGCGTEVEEIYLAAQSDVHTVLDQIETVQPALVIVDSVQTMST
SEADGVTGGVTQVRAVTAALTAAAKANEVALILVGHVTKDGAIAGPRSLEHLVDVVLHFE
GDRNGALRMVRGVKNRFGAADEVGCFLLHDNGIDGIVDPSNLFLDQRPTPVAGTAITVTL
DGKRPLVGEVQALLATPCGGSPRRAVSGIHQARAAMIAAVLEKHARLAIAVNDIYLSTVG
GMRLTEPSADLAVAIALASAYANLPLPTTAVMIGEVGLAGDIRRVNGMARRLSEAARQGF
TIALVPPSDDPVPPGMHALRASTIVAALQYMVDIADHRGTTLATPPSHSGTGHVPLGRGT