Protein Info for Rv3568c in Mycobacterium tuberculosis H37Rv

Annotation: 3,4-DHSA dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF22632: BphC_D1" amino acids 6 to 56 (51 residues), 90.9 bits, see alignment 3.5e-30 PF00903: Glyoxalase" amino acids 143 to 267 (125 residues), 70.1 bits, see alignment E=2.3e-23

Best Hits

Swiss-Prot: 100% identical to HSAC_MYCTO: Iron-dependent extradiol dioxygenase (hsaC) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00462, biphenyl-2,3-diol 1,2-dioxygenase [EC: 1.13.11.39] (inferred from 100% identity to mbo:Mb3599c)

MetaCyc: 100% identical to 3,4-dihydroxy-9,10-secoandrosta-1,3,5(10)-triene-9,17-dione 4,5-dioxygenase monomer (Mycobacterium tuberculosis H37Rv)
dioxygenase. [EC: 1.13.11.25]

Predicted SEED Role

"3,4-dihydroxy-9,10-seconandrost-1,3,5(10)-triene-9,17-dione dioxygenase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.25 or 1.13.11.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>Rv3568c 3,4-DHSA dioxygenase (Mycobacterium tuberculosis H37Rv)
MSIRSLGYLRIEATDMAAWREYGLKVLGMVEGKGAPEGALYLRMDDFPARLVVVPGEHDR
LLEAGWECANAEGLQEIRNRLDLEGTPYKEATAAELADRRVDEMIRFADPSGNCLEVFHG
TALEHRRVVSPYGHRFVTGEQGMGHVVLSTRDDAEALHFYRDVLGFRLRDSMRLPPQMVG
RPADGPPAWLRFFGCNPRHHSLAFLPMPTSSGIVHLMVEVEQADDVGLCLDRALRRKVPM
SATLGRHVNDLMLSFYMKTPGGFDIEFGCEGRQVDDRDWIARESTAVSLWGHDFTVGARG