Protein Info for Rv3546 in Mycobacterium tuberculosis H37Rv

Annotation: Probable acetyl-CoA acetyltransferase FadA5 (acetoacetyl-CoA thiolase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to FADA5_MYCTU: Steroid 3-ketoacyl-CoA thiolase (fadA5) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00626, acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (inferred from 100% identity to mra:MRA_3585)

MetaCyc: 100% identical to steroid 3-ketoacyl-CoA thiolase monomer (Mycobacterium tuberculosis H37Rv)
Propanoyl-CoA C-acyltransferase. [EC: 2.3.1.176]; Acetyl-CoA C-acyltransferase. [EC: 2.3.1.176, 2.3.1.16]

Predicted SEED Role

"Probable acetyl-CoA acetyltransferase FadA5 (EC 2.3.1.9)" (EC 2.3.1.9)

MetaCyc Pathways

androstenedione degradation I (aerobic) (22/25 steps found)
superpathway of cholesterol degradation I (cholesterol oxidase) (34/42 steps found)
superpathway of cholesterol degradation II (cholesterol dehydrogenase) (36/47 steps found)
superpathway of testosterone and androsterone degradation (22/28 steps found)
oleate β-oxidation (27/35 steps found)
benzoyl-CoA biosynthesis (3/3 steps found)
L-isoleucine degradation I (5/6 steps found)
fatty acid salvage (5/6 steps found)
superpathway of glyoxylate cycle and fatty acid degradation (10/14 steps found)
ketolysis (2/3 steps found)
cholesterol degradation to androstenedione I (cholesterol oxidase) (12/17 steps found)
propanoate fermentation to 2-methylbutanoate (4/6 steps found)
pyruvate fermentation to butanol II (engineered) (4/6 steps found)
acetoacetate degradation (to acetyl CoA) (1/2 steps found)
superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
valproate β-oxidation (6/9 steps found)
fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
glutaryl-CoA degradation (3/5 steps found)
pyruvate fermentation to hexanol (engineered) (7/11 steps found)
acetyl-CoA fermentation to butanoate (4/7 steps found)
fatty acid β-oxidation I (generic) (4/7 steps found)
pyruvate fermentation to butanoate (4/7 steps found)
2-methyl-branched fatty acid β-oxidation (9/14 steps found)
polyhydroxybutanoate biosynthesis (1/3 steps found)
5,6-dehydrokavain biosynthesis (engineered) (6/10 steps found)
glycerol degradation to butanol (10/16 steps found)
(R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (2/5 steps found)
4-hydroxybenzoate biosynthesis III (plants) (2/5 steps found)
ketogenesis (2/5 steps found)
pyruvate fermentation to butanol I (4/8 steps found)
cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (14/22 steps found)
(2S)-ethylmalonyl-CoA biosynthesis (1/4 steps found)
(8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (5/10 steps found)
1-butanol autotrophic biosynthesis (engineered) (17/27 steps found)
ethylbenzene degradation (anaerobic) (1/5 steps found)
fatty acid β-oxidation VII (yeast peroxisome) (1/5 steps found)
isopropanol biosynthesis (engineered) (1/5 steps found)
pyruvate fermentation to acetone (1/5 steps found)
3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
mevalonate pathway I (eukaryotes and bacteria) (2/7 steps found)
mevalonate pathway II (haloarchaea) (2/7 steps found)
L-lysine fermentation to acetate and butanoate (4/10 steps found)
10-trans-heptadecenoyl-CoA degradation (MFE-dependent, yeast) (1/6 steps found)
4-ethylphenol degradation (anaerobic) (1/6 steps found)
superpathway of Clostridium acetobutylicum solventogenic fermentation (6/13 steps found)
benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (15/26 steps found)
2-deoxy-D-ribose degradation II (2/8 steps found)
2-methylpropene degradation (2/8 steps found)
isoprene biosynthesis II (engineered) (2/8 steps found)
mevalonate pathway III (Thermoplasma) (2/8 steps found)
mevalonate pathway IV (archaea) (2/8 steps found)
3-phenylpropanoate degradation (3/10 steps found)
superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
L-glutamate degradation VII (to butanoate) (4/12 steps found)
sitosterol degradation to androstenedione (8/18 steps found)
9-cis, 11-trans-octadecadienoyl-CoA degradation (isomerase-dependent, yeast) (2/10 steps found)
methyl tert-butyl ether degradation (2/10 steps found)
4-oxopentanoate degradation (1/9 steps found)
ethylmalonyl-CoA pathway (2/11 steps found)
(4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (3/13 steps found)
androstenedione degradation II (anaerobic) (13/27 steps found)
L-tryptophan degradation III (eukaryotic) (4/15 steps found)
docosahexaenoate biosynthesis III (6-desaturase, mammals) (3/14 steps found)
10-cis-heptadecenoyl-CoA degradation (yeast) (1/12 steps found)
10-trans-heptadecenoyl-CoA degradation (reductase-dependent, yeast) (1/12 steps found)
crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
benzoate fermentation (to acetate and cyclohexane carboxylate) (3/17 steps found)
jasmonic acid biosynthesis (4/19 steps found)
toluene degradation VI (anaerobic) (3/18 steps found)
platensimycin biosynthesis (7/26 steps found)
superpathway of cholesterol degradation III (oxidase) (23/49 steps found)
superpathway of ergosterol biosynthesis I (6/26 steps found)
Methanobacterium thermoautotrophicum biosynthetic metabolism (23/56 steps found)
bile acid biosynthesis, neutral pathway (2/29 steps found)
superpathway of L-lysine degradation (10/43 steps found)
superpathway of cholesterol biosynthesis (6/38 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.16, 2.3.1.9

Use Curated BLAST to search for 2.3.1.16 or 2.3.1.176 or 2.3.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>Rv3546 Probable acetyl-CoA acetyltransferase FadA5 (acetoacetyl-CoA thiolase) (Mycobacterium tuberculosis H37Rv)
MGYPVIVEATRSPIGKRNGWLSGLHATELLGAVQKAVVDKAGIQSGLHAGDVEQVIGGCV
TQFGEQSNNISRVAWLTAGLPEHVGATTVDCQCGSGQQANHLIAGLIAAGAIDVGIACGI
EAMSRVGLGANAGPDRSLIRAQSWDIDLPNQFEAAERIAKRRGITREDVDVFGLESQRRA
QRAWAEGRFDREISPIQAPVLDEQNQPTGERRLVFRDQGLRETTMAGLGELKPVLEGGIH
TAGTSSQISDGAAAVLWMDEAVARAHGLTPRARIVAQALVGAEPYYHLDGPVQSTAKVLE
KAGMKIGDIDIVEINEAFASVVLSWARVHEPDMDRVNVNGGAIALGHPVGCTGSRLITTA
LHELERTDQSLALITMCAGGALSTGTIIERI