Protein Info for Rv3497c in Mycobacterium tuberculosis H37Rv

Annotation: Mce-family protein Mce4C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details TIGR00996: virulence factor Mce family protein" amino acids 17 to 296 (280 residues), 277.4 bits, see alignment E=6.4e-87 PF02470: MlaD" amino acids 44 to 118 (75 residues), 67.1 bits, see alignment E=1.4e-22 PF11887: Mce4_CUP1" amino acids 125 to 312 (188 residues), 42.6 bits, see alignment E=5.7e-15

Best Hits

KEGG orthology group: K02067, putative ABC transport system substrate-binding protein (inferred from 99% identity to mbb:BCG_3561c)

Predicted SEED Role

"MCE-family protein Mce1C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>Rv3497c Mce-family protein Mce4C (Mycobacterium tuberculosis H37Rv)
LLNRKPSSKHERDPLRTGIFGLVLVICVVLIAFGYSGLPFWPQGKTYDAYFTDAGGITPG
NSVYVSGLKVGAVSAVSLAGNSAKVTFSVDRSIVVGDQSLAAIRTDTILGERSIAVSPAG
SGKSTTIPLSRTTTPYTLNGVLQDLGRNANDLNRPQFEQALNVFTQALHDATPQVRGAVD
GLTSLSRALNRRDEALQGLLAHAKSVTSVLSERAEQVNKLVEDGNQLFAALDARRAALSA
LISGIDDVAAQISGFVADNRKEFGPALSKLNLVLANLNERRDYITEALKRLPTYATTLGE
VVGSGPGFNVNVYSVLPGPLVATVFDLVFQPGKLPDSLADYLRGFIQERWIIRPKSP