Protein Info for Rv3456c in Mycobacterium tuberculosis H37Rv

Annotation: 50S ribosomal protein L17 RplQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 TIGR00059: ribosomal protein bL17" amino acids 8 to 116 (109 residues), 137 bits, see alignment E=1.6e-44 PF01196: Ribosomal_L17" amino acids 21 to 116 (96 residues), 137.3 bits, see alignment E=1.4e-44

Best Hits

Swiss-Prot: 100% identical to RL17_MYCBT: 50S ribosomal protein L17 (rplQ) from Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)

KEGG orthology group: K02879, large subunit ribosomal protein L17 (inferred from 99% identity to mtc:MT3563)

Predicted SEED Role

"LSU ribosomal protein L17p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>Rv3456c 50S ribosomal protein L17 RplQ (Mycobacterium tuberculosis H37Rv)
MPKPTKGPRLGGSSSHQKAILANLATSLFEHGRITTTEPKARALRPYAEKLITHAKKGAL
HNRREVLKKLRDKDVVHTLFAEIGPFFADRDGGYTRIIKIEARKGDNAPMAVIELVREKT
VTSEANRARRVAAAQAKAKKAAAMPTEESEAKPAEEGDVVGASEPDAKAPEEPPAEAPEN