Protein Info for Rv3448 in Mycobacterium tuberculosis H37Rv

Annotation: ESX conserved component EccD4. ESX-4 type VII secretion system protein. Probable integral membrane protein.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 120 to 141 (22 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 206 to 224 (19 residues), see Phobius details amino acids 232 to 255 (24 residues), see Phobius details amino acids 261 to 285 (25 residues), see Phobius details amino acids 317 to 340 (24 residues), see Phobius details amino acids 346 to 364 (19 residues), see Phobius details amino acids 375 to 393 (19 residues), see Phobius details amino acids 402 to 424 (23 residues), see Phobius details amino acids 436 to 459 (24 residues), see Phobius details PF08817: YukD" amino acids 9 to 83 (75 residues), 73.7 bits, see alignment E=1.6e-24 TIGR03920: type VII secretion integral membrane protein EccD" amino acids 11 to 461 (451 residues), 415.1 bits, see alignment E=1.8e-128 PF19053: EccD" amino acids 118 to 462 (345 residues), 130.1 bits, see alignment E=9.3e-42

Best Hits

Swiss-Prot: 100% identical to ECCD4_MYCTO: ESX-4 secretion system protein eccD4 (eccD4) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mbo:Mb3478)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>Rv3448 ESX conserved component EccD4. ESX-4 type VII secretion system protein. Probable integral membrane protein. (Mycobacterium tuberculosis H37Rv)
MPTSDPGLRRVTVHAGAQAVDLTLPAAVPVATLIPSIVDILGDRGASPATAARYQLSALG
APALPNATTLAQCGIRDGAVLVLHKSSAQPPTPRCDDVAEAVAAALDTTARPQCQRTTRL
SGALAASCITAGGGLMLVRNALGTNVTRYSDATAGVVAAAGLAALLFAVIACRTYRDPIA
GLTLSVIATIFGAVAGLLAVPGVPGVHSVLVAAMAAAATSVLAMRITGCGGITLTAVACC
AVVVAAATLVGAITAAPVPAIGSLATLASFGLLEVSARMAVLLAGLSPRLPPALNPDDAD
ALPTTDRLTTRANRADAWLTSLLAAFAASATIGAIGTAVATHGIHRSSMGGIALAAVTGA
LLLLRARSADTRRSLVFAICGITTVATAFTVAADRALEHGPWIAALTAMLAAVAMFLGFV
APALSLSPVTYRTIELLECLALIAMVPLTAWLCGAYSAVRHLDLTWT