Protein Info for Rv3436c in Mycobacterium tuberculosis H37Rv

Annotation: Probable glucosamine--fructose-6-phosphate aminotransferase [isomerizing] GlmS (hexosephosphate aminotransferase) (D-fructose-6-phosphate amidotransferase) (GFAT) (L-glutamine-D-fructose-6-phosphate amidotransferase) (glucosamine-6-phosphate synthase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 624 TIGR01135: glutamine-fructose-6-phosphate transaminase (isomerizing)" amino acids 2 to 624 (623 residues), 822 bits, see alignment E=1.6e-251 PF13522: GATase_6" amino acids 67 to 200 (134 residues), 73.4 bits, see alignment E=2.7e-24 PF13537: GATase_7" amino acids 84 to 204 (121 residues), 50.8 bits, see alignment E=2.6e-17 PF01380: SIS" amino acids 301 to 427 (127 residues), 126.9 bits, see alignment E=7.1e-41 amino acids 473 to 603 (131 residues), 67.8 bits, see alignment E=1.3e-22

Best Hits

Swiss-Prot: 100% identical to GLMS_MYCTO: Glutamine--fructose-6-phosphate aminotransferase [isomerizing] (glmS) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00820, glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC: 2.6.1.16] (inferred from 100% identity to mbt:JTY_3502)

Predicted SEED Role

"Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (EC 2.6.1.16)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.6.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (624 amino acids)

>Rv3436c Probable glucosamine--fructose-6-phosphate aminotransferase [isomerizing] GlmS (hexosephosphate aminotransferase) (D-fructose-6-phosphate amidotransferase) (GFAT) (L-glutamine-D-fructose-6-phosphate amidotransferase) (glucosamine-6-phosphate synthase) (Mycobacterium tuberculosis H37Rv)
VCGIVGYVGRRPAYVVVMDALRRMEYRGYDSSGIALVDGGTLTVRRRAGRLANLEEAVAE
MPSTALSGTTGLGHTRWATHGRPTDRNAHPHRDAAGKIAVVHNGIIENFAVLRRELETAG
VEFASDTDTEVAAHLVARAYRHGETADDFVGSVLAVLRRLEGHFTLVFANADDPGTLVAA
RRSTPLVLGIGDNEMFVGSDVAAFIEHTREAVELGQDQAVVITADGYRISDFDGNDGLQA
GRDFRPFHIDWDLAAAEKGGYEYFMLKEIAEQPAAVADTLLGHFVGGRIVLDEQRLSDQE
LREIDKVFVVACGTAYHSGLLAKYAIEHWTRLPVEVELASEFRYRDPVLDRSTLVVAISQ
SGETADTLEAVRHAKEQKAKVLAICNTNGSQIPRECDAVLYTRAGPEIGVASTKTFLAQI
AANYLLGLALAQARGTKYPDEVEREYHELEAMPDLVARVIAATGPVAELAHRFAQSSTVL
FLGRHVGYPVALEGALKLKELAYMHAEGFAAGELKHGPIALIEDGLPVIVVMPSPKGSAT
LHAKLLSNIREIQTRGAVTIVIAEEGDETVRPYADHLIEIPAVSTLLQPLLSTIPLQVFA
ASVARARGYDVDKPRNLAKSVTVE