Protein Info for Rv3397c in Mycobacterium tuberculosis H37Rv

Annotation: Probable phytoene synthase PhyA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 TIGR03465: squalene synthase HpnD" amino acids 15 to 279 (265 residues), 313.9 bits, see alignment E=3.4e-98 PF00494: SQS_PSY" amino acids 16 to 268 (253 residues), 212 bits, see alignment E=6.8e-67

Best Hits

Swiss-Prot: 100% identical to CRTB_MYCTU: Phytoene synthase (crtB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02291, phytoene synthase [EC: 2.5.1.32] (inferred from 100% identity to mtu:Rv3397c)

Predicted SEED Role

"Phytoene synthase (EC 2.5.1.32)" in subsystem Carotenoids (EC 2.5.1.32)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>Rv3397c Probable phytoene synthase PhyA (Mycobacterium tuberculosis H37Rv)
MTEIEQAYRITESITRTAARNFYYGIRLLPREKRAALSAVYALGRRIDDVADGELAPETK
ITELDAIRKSLDNIDDSSDPVLVALADAARRFPVPIAMFAELIDGARMEIDWTGCRDFDE
LIVYCRRGAGTIGKLCLSIFGPVSTATSRYAEQLGIALQQTNILRDVREDFLNGRIYLPR
DELDRLGVRLRLDDTGALDDPDGRLAALLRFSADRAADWYSLGLRLIPHLDRRSAACCAA
MSGIYRRQLALIRASPAVVYDRRISLSGLKKAQVAAAALASSVTCGPAHGPLPADLGSHP
SH