Protein Info for Rv3391 in Mycobacterium tuberculosis H37Rv

Annotation: Possible multi-functional enzyme with acyl-CoA-reductase activity AcrA1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 transmembrane" amino acids 461 to 474 (14 residues), see Phobius details PF01370: Epimerase" amino acids 4 to 170 (167 residues), 57 bits, see alignment E=7.2e-19 PF07993: NAD_binding_4" amino acids 5 to 218 (214 residues), 100.1 bits, see alignment E=4.3e-32 PF16363: GDP_Man_Dehyd" amino acids 5 to 83 (79 residues), 27.3 bits, see alignment E=8.8e-10 PF13460: NAD_binding_10" amino acids 7 to 171 (165 residues), 33.9 bits, see alignment E=1.1e-11 PF00106: adh_short" amino acids 354 to 543 (190 residues), 157.2 bits, see alignment E=1.3e-49 PF08659: KR" amino acids 355 to 521 (167 residues), 55 bits, see alignment E=3.5e-18 PF13561: adh_short_C2" amino acids 359 to 552 (194 residues), 115.6 bits, see alignment E=9.7e-37

Best Hits

KEGG orthology group: K00155, [EC: 1.2.1.-] (inferred from 100% identity to mbo:Mb3423)

Predicted SEED Role

"Possible multi-functional enzyme with acyl-CoA-reductase activity AcrA1"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-

Use Curated BLAST to search for 1.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (650 amino acids)

>Rv3391 Possible multi-functional enzyme with acyl-CoA-reductase activity AcrA1 (Mycobacterium tuberculosis H37Rv)
MRYVVTGGTGFIGRHVVSRLLDGRPEARLWALVRRQSLSRFERLAGQWGDRVRPLVGDLT
ELELSERTIAELGDIDHVLHCAAVHDTTWADATRAVIELAARLDATFHHVSSIAVAGDFA
GHYTEADFDVGQRLPTPYHRMTFEAERLVRSTPGLRYRIYRPAVVVGDSRTGEMDTIDGP
YYLFGVLAKLAVLPSFTPMLLPDIGRTNIVPVDYVADALVALMHADGRDGQTFHLTAPTA
IGLRGIYRGIAGAAGLPPLLGTLPGFVAAPVLNARGRAKVLRNMAATQLGIPAEIFDVVG
CAPTFTSDTTREALRGTGIHVPEFATYAPGLWRYWAEHLDPDRARRNDPLLGRHVIITGA
SSGIGRASAIAVAKRGATVFALARNGNALDELVTEIRAHGGQAHAFTCDVTDSASVEHTV
KDILGRFDHVDYLVNNAGRSIRRSVVNSTDRLHDYERVMAVNYFGAVRMVLALLPHWRER
RFGHVVNVSSAGVQARNPKYSSYLPTKAALDAFADVVASETLSDHITFTNIHMPLVATPM
IVPSRRLNPVRAISAERAAAMVIRGLVEKPARIDTPLGTLAEAGNYVAPRLSRRILHQLY
LGYPDSAAAQGISRPDADRPPAPRRPRRSARAGVPRPLRRLGRLVPGVHW