Protein Info for Rv3335c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 42 to 65 (24 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 225 to 248 (24 residues), see Phobius details amino acids 259 to 285 (27 residues), see Phobius details TIGR00766: inner membrane protein YhjD" amino acids 21 to 289 (269 residues), 402.1 bits, see alignment E=4.8e-125 PF03631: Virul_fac_BrkB" amino acids 32 to 287 (256 residues), 141.2 bits, see alignment E=2.5e-45

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 100% identity to mbb:BCG_3406c)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>Rv3335c Probable conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
MGELAEPGVLDRLRARFGWLDHVVRAFTRFNDRNGSLFAAGLTYYTIFAIFPLLMVGFGV
GGFALSRRPELLTTLEERIRTSVSGAVGQQLVDLMNSAIDARASVGVIGLATAAWVGLGW
MWHLREALSQMWAHPVAPAGYLRTKLSDLAAMVGTFVVIVATIALTVLGHARPMAAVLRW
LEIPQFSVFDEIFRGISVLVSVLVSWVLFTWMIGRLPREPVGLVTAARAGLMAAVGFELF
KQVGAIYLQIVLRSPAGAVFGPVLGLMVFAFVTAWLILFATAWAATASA