Protein Info for Rv3238c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 41 to 65 (25 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 123 to 146 (24 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 193 to 211 (19 residues), see Phobius details

Best Hits

Swiss-Prot: 100% identical to MDDA_MYCTU: Methanethiol S-methyltransferase (mddA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mbo:Mb3266c)

MetaCyc: 49% identical to methanethiol S-methyltransferase (Pseudomonas deceptionensis)
RXN-17813 [EC: 2.1.1.334]

Predicted SEED Role

"putative conserved integral membrane protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.334

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>Rv3238c Probable conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
MKRYLTIIYGAASYLVFLVAFGYAIGFVGDVVVPRTVDHAIAAPIGQAVVVNLVLLGVFA
VQHSVMARQGFKRWWTRFVPPSIERSTYVLLASVALLLLYWQWRTMPAVIWDVRQPAGRV
ALWALFWLGWATVLTSTFMINHFELFGLRQVYLAWRGKPYTEIGFQAHLLYRWVRHPIML
GFVVAFWATPMMTAGHLLFAIGATGYILVALQFEERDLLAALGDQYRDYRREVSMLLPWP
HRHT