Protein Info for Rv3197A in Mycobacterium tuberculosis H37Rv

Annotation: Probable transcriptional regulatory protein WhiB-like WhiB7

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 92 PF02467: Whib" amino acids 20 to 68 (49 residues), 53.3 bits, see alignment E=3.4e-18 PF02178: AT_hook" amino acids 80 to 91 (12 residues), 16.9 bits, see alignment (E = 4.3e-07)

Best Hits

Swiss-Prot: 99% identical to WHB7A_MYCTU: Probable transcriptional regulator WhiB7 (whiB7) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 99% identity to mbt:JTY_3216)

Predicted SEED Role

"WhiB-family transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (92 amino acids)

>Rv3197A Probable transcriptional regulatory protein WhiB-like WhiB7 (Mycobacterium tuberculosis H37Rv)
VSVLTVPRQTPRQRLPVLPCHVGDPDLWFADTPAGLEVAKTLCVSCPIRRQCLAAALQRA
EPWGVWGGEIFDQGSIVSHKRPRGRPRKDAVA