Protein Info for Rv3097c in Mycobacterium tuberculosis H37Rv

Annotation: PE-PGRS family protein, triacylglycerol lipase LipY (esterase/lipase) (triglyceride lipase) (tributyrase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 PF00934: PE" amino acids 5 to 95 (91 residues), 107.3 bits, see alignment E=5.9e-35 PF07859: Abhydrolase_3" amino acids 235 to 416 (182 residues), 70.3 bits, see alignment E=3e-23 PF10340: Say1_Mug180" amino acids 235 to 343 (109 residues), 32.3 bits, see alignment E=7.4e-12

Best Hits

Swiss-Prot: 100% identical to LIPY_MYCTU: Triacylglycerol lipase (lipY) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtc:MT3181)

Predicted SEED Role

"PE family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>Rv3097c PE-PGRS family protein, triacylglycerol lipase LipY (esterase/lipase) (triglyceride lipase) (tributyrase) (Mycobacterium tuberculosis H37Rv)
VVSYVVALPEVMSAAATDVASIGSVVATASQGVAGATTTVLAAAEDEVSAAIAALFSGHG
QDYQALSAQLAVFHERFVQALTGAAKGYAAAELANASLLQSEFASGIGNGFATIHQEIQR
APTALAAGFTQVPPFAAAQAGIFTGTPSGAAGFDIASLWPVKPLLSLSALETHFAIPNNP
LLALIASDIPPLSWFLGNSPPPLLNSLLGQTVQYTTYDGMSVVQITPAHPTGEYVVAIHG
GAFILPPSIFHWLNYSVTAYQTGATVQVPIYPLVQEGGTAGTVVPAMAGLISTQIAQHGV
SNVSVVGDSAGGNLALAAAQYMVSQGNPVPSSMVLLSPWLDVGTWQISQAWAGNLAVNDP
LVSPLYGSLNGLPPTYVYSGSLDPLAQQAVVLEHTAVVQGAPFSFVLAPWQIHDWILLTP
WGLLSWPQINQQLGIAA