Protein Info for Rv3084 in Mycobacterium tuberculosis H37Rv

Annotation: Probable acetyl-hydrolase/esterase LipR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 PF20434: BD-FAE" amino acids 69 to 160 (92 residues), 27 bits, see alignment E=4.8e-10 PF10340: Say1_Mug180" amino acids 71 to 191 (121 residues), 41 bits, see alignment E=1.7e-14 PF07859: Abhydrolase_3" amino acids 72 to 272 (201 residues), 149.9 bits, see alignment E=1.3e-47

Best Hits

Swiss-Prot: 100% identical to LIPR_MYCTO: Putative acetyl-hydrolase LipR (lipR) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K01066, esterase / lipase [EC: 3.1.1.-] (inferred from 100% identity to mbb:BCG_3109)

MetaCyc: 39% identical to N-acetyl-phophinothricyl-L-alanyl-L-leucine acetyl hydrolase (Kitasatospora phosalacinea)
3.1.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-

Use Curated BLAST to search for 3.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>Rv3084 Probable acetyl-hydrolase/esterase LipR (Mycobacterium tuberculosis H37Rv)
MNLRKNVIRSVLRGARPLFASRRLGIAGRRVLLATLTAGARAPKGTRFQRVSIAGVPVQR
VQPPHAATSGTLIYLHGGAYALGSARGYRGLAAQLAAAAGMTALVPDYTRAPHAHYPVAL
EEMAAVYTRLLDDGLDPKTTVIAGDSAGGGLTLALAMALRDRGIQAPAALGLICPWADLA
VDIEATRPALRDPLILPSMCTEWAPRYVGSSDPRLPGISPVYGDMSGLPPIVMQTAGDDP
ICVDADKIETACAASKTSIEHRRFAGMWHDFHLQVSLLPEARDAIADLGARLRGHLHQSQ
GQPRGVVK