Protein Info for Rv3065 in Mycobacterium tuberculosis H37Rv

Annotation: Multidrugs-transport integral membrane protein Mmr

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details PF00893: Multi_Drug_Res" amino acids 2 to 94 (93 residues), 102.5 bits, see alignment E=7.6e-34

Best Hits

Swiss-Prot: 99% identical to MMR_MYCTO: Multidrug resistance protein Mmr (mmr) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03297, small multidrug resistance protein, SMR family (inferred from 99% identity to mtf:TBFG_13082)

MetaCyc: 44% identical to DLP12 prophage; multidrug/betaine/choline efflux transporter EmrE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-344; TRANS-RXN0-493; TRANS-RXN0-532; TRANS-RXN0-533; TRANS-RXN0-628

Predicted SEED Role

"Multidrug resistance protein Mmr"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (107 amino acids)

>Rv3065 Multidrugs-transport integral membrane protein Mmr (Mycobacterium tuberculosis H37Rv)
LIYLYLLCAIFAEVVATSLLKSTEGFTRLWPTVGCLVGYGIAFALLALSISHGMQTDVAY
ALWSAIGTAAIVLVAVLFLGSPISVMKVVGVGLIVVGVVTLNLAGAH