Protein Info for Rv3045 in Mycobacterium tuberculosis H37Rv

Annotation: Probable NADP-dependent alcohol dehydrogenase AdhC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 PF08240: ADH_N" amino acids 27 to 146 (120 residues), 98.5 bits, see alignment E=2.6e-32 PF00107: ADH_zinc_N" amino acids 185 to 307 (123 residues), 67.9 bits, see alignment E=8.9e-23

Best Hits

Swiss-Prot: 100% identical to ADHC_MYCBO: NADP-dependent alcohol dehydrogenase C (adhC) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K13979, uncharacterized zinc-type alcohol dehydrogenase-like protein [EC: 1.-.-.-] (inferred from 100% identity to mtu:Rv3045)

MetaCyc: 62% identical to S-(hydroxymethyl)bacillithiol dehydrogenase (Bacillus subtilis subtilis 168)
RXN-18814 [EC: 1.1.1.306]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 1.1.1.1, 1.1.1.306

Use Curated BLAST to search for 1.-.-.- or 1.1.1.1 or 1.1.1.306

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>Rv3045 Probable NADP-dependent alcohol dehydrogenase AdhC (Mycobacterium tuberculosis H37Rv)
MSTVAAYAAMSATEPLTKTTITRRDPGPHDVAIDIKFAGICHSDIHTVKAEWGQPNYPVV
PGHEIAGVVTAVGSEVTKYRQGDRVGVGCFVDSCRECNSCTRGIEQYCKPGANFTYNSIG
KDGQPTQGGYSEAIVVDENYVLRIPDVLPLDVAAPLLCAGITLYSPLRHWNAGANTRVAI
IGLGGLGHMGVKLGAAMGADVTVLSQSLKKMEDGLRLGAKSYYATADPDTFRKLRGGFDL
ILNTVSANLDLGQYLNLLDVDGTLVELGIPEHPMAVPAFALALMRRSLAGSNIGGIAETQ
EMLNFCAEHGVTPEIELIEPDYINDAYERVLASDVRYRFVIDISAL