Protein Info for Rv3045 in Mycobacterium tuberculosis H37Rv
Annotation: Probable NADP-dependent alcohol dehydrogenase AdhC
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to ADHC_MYCBO: NADP-dependent alcohol dehydrogenase C (adhC) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
KEGG orthology group: K13979, uncharacterized zinc-type alcohol dehydrogenase-like protein [EC: 1.-.-.-] (inferred from 100% identity to mtu:Rv3045)MetaCyc: 62% identical to S-(hydroxymethyl)bacillithiol dehydrogenase (Bacillus subtilis subtilis 168)
RXN-18814 [EC: 1.1.1.306]
Predicted SEED Role
"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)
MetaCyc Pathways
- noradrenaline and adrenaline degradation (12/13 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
- superpathway of anaerobic sucrose degradation (16/19 steps found)
- mixed acid fermentation (13/16 steps found)
- 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
- ethanol degradation II (3/3 steps found)
- ethanol degradation I (2/2 steps found)
- pyruvate fermentation to ethanol II (2/2 steps found)
- (S)-propane-1,2-diol degradation (4/5 steps found)
- acetylene degradation (anaerobic) (4/5 steps found)
- ethanolamine utilization (4/5 steps found)
- pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
- acetaldehyde biosynthesis I (1/1 steps found)
- superpathway of N-acetylneuraminate degradation (16/22 steps found)
- L-phenylalanine degradation III (3/4 steps found)
- phytol degradation (3/4 steps found)
- heterolactic fermentation (13/18 steps found)
- L-isoleucine degradation II (2/3 steps found)
- L-leucine degradation III (2/3 steps found)
- L-methionine degradation III (2/3 steps found)
- L-valine degradation II (2/3 steps found)
- formaldehyde oxidation III (mycothiol-dependent) (2/3 steps found)
- formaldehyde oxidation V (bacillithiol-dependent) (2/3 steps found)
- pyruvate fermentation to ethanol I (2/3 steps found)
- pyruvate fermentation to ethanol III (2/3 steps found)
- L-tyrosine degradation III (2/4 steps found)
- salidroside biosynthesis (2/4 steps found)
- serotonin degradation (4/7 steps found)
- superpathway of fermentation (Chlamydomonas reinhardtii) (5/9 steps found)
- phenylethanol biosynthesis (2/5 steps found)
- butanol and isobutanol biosynthesis (engineered) (4/8 steps found)
- cytidine-5'-diphosphate-glycerol biosynthesis (1/4 steps found)
- methanol oxidation to carbon dioxide (2/6 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (6/13 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
- L-tryptophan degradation V (side chain pathway) (1/13 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- 3-Chloroacrylic acid degradation
- Alkaloid biosynthesis I
- Carotenoid biosynthesis - General
- Drug metabolism - cytochrome P450
- Fatty acid metabolism
- Glycine, serine and threonine metabolism
- Glycolysis / Gluconeogenesis
- Insect hormone biosynthesis
- Metabolism of xenobiotics by cytochrome P450
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Retinol metabolism
- Trinitrotoluene degradation
- Tyrosine metabolism
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-, 1.1.1.1, 1.1.1.306
Use Curated BLAST to search for 1.-.-.- or 1.1.1.1 or 1.1.1.306
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (346 amino acids)
>Rv3045 Probable NADP-dependent alcohol dehydrogenase AdhC (Mycobacterium tuberculosis H37Rv) MSTVAAYAAMSATEPLTKTTITRRDPGPHDVAIDIKFAGICHSDIHTVKAEWGQPNYPVV PGHEIAGVVTAVGSEVTKYRQGDRVGVGCFVDSCRECNSCTRGIEQYCKPGANFTYNSIG KDGQPTQGGYSEAIVVDENYVLRIPDVLPLDVAAPLLCAGITLYSPLRHWNAGANTRVAI IGLGGLGHMGVKLGAAMGADVTVLSQSLKKMEDGLRLGAKSYYATADPDTFRKLRGGFDL ILNTVSANLDLGQYLNLLDVDGTLVELGIPEHPMAVPAFALALMRRSLAGSNIGGIAETQ EMLNFCAEHGVTPEIELIEPDYINDAYERVLASDVRYRFVIDISAL