Protein Info for Rv2962c in Mycobacterium tuberculosis H37Rv

Annotation: Possible glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 PF04101: Glyco_tran_28_C" amino acids 283 to 415 (133 residues), 26.5 bits, see alignment E=9.2e-10 PF00201: UDPGT" amino acids 293 to 417 (125 residues), 32.6 bits, see alignment E=6.4e-12 PF06722: EryCIII-like_C" amino acids 295 to 419 (125 residues), 64.6 bits, see alignment E=1.6e-21

Best Hits

Swiss-Prot: 100% identical to RNTF_MYCBP: PGL/p-HBAD biosynthesis rhamnosyltransferase (BCG_2983c) from Mycobacterium bovis (strain BCG / Pasteur 1173P2)

KEGG orthology group: None (inferred from 100% identity to mbo:Mb2986c)

MetaCyc: 100% identical to dimycocerosyl phenolphthiocerol rhamnosyltransferase (Mycobacterium tuberculosis H37Rv)
2.4.1.M3 [EC: 2.4.1.M3]; 2.4.1.M3 [EC: 2.4.1.M3]

Predicted SEED Role

"UDP-glucoronosyl and UDP-glucosyltransferases family protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.M3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>Rv2962c Possible glycosyl transferase (Mycobacterium tuberculosis H37Rv)
VRVSCVYATASRWGGPPVASEVRGDAAISTTPDAAPGLAARRRRILFVAEAVTLAHVVRP
FALAQSLDPSRYEVHFACDPRYNQLLGPLPFRHHAIHTIPSERFFGNLTQGRFYAMRTLR
KYVEADLRVLDEIAPDLVVGDLRISLSVSARLAGIPYIAIANAYWSPYAQRRFPLPDVIW
TRLFGVRLVKLLYRLERPLLFALQCMPLNWVRRRHGLSSLGWNLCRIFTDGDHTLYADVP
ELMPTYDLPANHEYLGPVLWSPAGKPPTWWDSLPTDRPIVYATLGTSGGRNLLQLVLNAL
AELPVTVIAATAGRSDLKTVPANAFVADYLPGEAAAARSAVVVCNGGSLTTQQALVAGVP
VIGVAGNLDQHLNMEAVERAGAGVLLRTERLKSQRVAGAVMQVISRSEYRQAAARLADAF
GRDRVGFPQHVENALRLMPENRPRTWLAS