Protein Info for Rv2954c in Mycobacterium tuberculosis H37Rv

Annotation: Hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF13489: Methyltransf_23" amino acids 34 to 131 (98 residues), 33.7 bits, see alignment E=7.4e-12 PF08003: Methyltransf_9" amino acids 37 to 153 (117 residues), 25.4 bits, see alignment E=1.7e-09 PF13649: Methyltransf_25" amino acids 43 to 125 (83 residues), 43.6 bits, see alignment E=1e-14 PF08241: Methyltransf_11" amino acids 44 to 125 (82 residues), 39.5 bits, see alignment E=1.9e-13 PF08242: Methyltransf_12" amino acids 44 to 125 (82 residues), 45.1 bits, see alignment E=3.5e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_2970)

MetaCyc: 100% identical to [2,4-di-O-methyl-alpha-L-fucopyranosyl-(1->3)-alpha-L-rhamnopyranosyl-(1->3)-2-O-methyl-alpha-L-rhamnopyranosyl] dimycocerosyl phenol-phthiocerol 3'''-O-methyltransferase (Mycobacterium tuberculosis H37Rv)
2.1.1.M16 [EC: 2.1.1.M16]; 2.1.1.M16 [EC: 2.1.1.M16]

Predicted SEED Role

"FIG00821261: hypothetical protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.M16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>Rv2954c Hypothetical protein (Mycobacterium tuberculosis H37Rv)
MRLPGMLRPTAERHFHSIFYLRHNARRQEHLATLGLDLGNKSVLEVGAGIGDHTQFFLDR
GCKVLCTEPRGENLDVIRQRFGSNPNVTVDHLDLDGDLPAEAHQYDVVYCYGVLYHLSRP
AEALAWMCDRAVDLLLLETCVSYSGEDEPFLVSERASSPSQAITGTGCRPSRVWVMNRLR
EKMPHVYVTATQPRHRQFPLDWRANGPIASTGLARAVFVASRAPLNLPTLVEELPMVQRR
C