Protein Info for Rv2951c in Mycobacterium tuberculosis H37Rv

Annotation: Possible oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 PF00296: Bac_luciferase" amino acids 30 to 346 (317 residues), 168.1 bits, see alignment E=1.6e-53

Best Hits

Swiss-Prot: 100% identical to PHKR_MYCTU: Phthiodiolone/phenolphthiodiolone dimycocerosates ketoreductase (Rv2951c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K14728, phthiodiolone/phenolphthiodiolone dimycocerosates ketoreductase [EC: 1.2.-.-] (inferred from 100% identity to mtc:MT3025)

MetaCyc: 100% identical to (phenol)phthiodiolone ketoreductase (Mycobacterium tuberculosis variant bovis)
1.1.1.M11 [EC: 1.1.1.M11]; 1.1.1.M11 [EC: 1.1.1.M11]; 1.1.1.M11 [EC: 1.1.1.M11]; 1.1.1.M11 [EC: 1.1.1.M11]

Predicted SEED Role

"N5,N10-methylenetetrahydromethanopterin reductase-related protein, BCG_2972c group"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.M11 or 1.2.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>Rv2951c Possible oxidoreductase (Mycobacterium tuberculosis H37Rv)
VGGLRFGFVDALVHSRLPPTLPARSSMAAATVMGADSYWVGDHLNALVPRSIATSEYLGI
AAKFVPKIDANYEPWTMLGNLAFGLPSRLRLGVCVTDAGRRNPAVTAQAAATLHLLTRGR
AILGIGVGEREGNEPYGVEWTKPVARFEEALATIRALWNSNGELISRESPYFPLHNALFD
LPPYRGKWPEIWVAAHGPRMLRATGRYADAWIPIVVVRPSDYSRALEAVRSAASDAGRDP
MSITPAAVRGIITGRNRDDVEEALESVVVKMTALGVPGEAWARHGVEHPMGADFSGVQDI
IPQTMDKQTVLSYAAKVPAALMKEVVFSGTPDEVIDQVAEWRDHGLRYVVLINGSLVNPS
LRKTVTAVLPHAKVLRGLKKL